PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN16853.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family WRKY
Protein Properties Length: 147aa    MW: 17141.3 Da    PI: 10.2319
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN16853.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY97.11.2e-3067125159
                 ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                 ldDgy+WrKYG K+vk+++fpr+YYrC+++gC+vkk+++r ++d+++v++tYeg H h+
  KHN16853.1  67 LDDGYRWRKYGEKSVKNNKFPRNYYRCSYRGCNVKKQIQRHSKDEEIVVTTYEGIHIHP 125
                 59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.5E-3152125IPR003657WRKY domain
SuperFamilySSF1182901.96E-2759126IPR003657WRKY domain
PROSITE profilePS5081128.75962127IPR003657WRKY domain
SMARTSM007745.3E-3567126IPR003657WRKY domain
PfamPF031067.9E-2568125IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MEKHQVLSPI SSSSSTSPSD FKLGDHNSNA HVKKAGLLKT QRPSLKGGKE IKQHRYAFQT  60
RSHVDILDDG YRWRKYGEKS VKNNKFPRNY YRCSYRGCNV KKQIQRHSKD EEIVVTTYEG  120
IHIHPVEKST ESFEQILRNH HIYSLTL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-2657124774Probable WRKY transcription factor 4
2lex_A8e-2657124774Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0195670.0EU019567.1 Glycine max WRKY25 (WRKY25) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001237010.17e-93WRKY25 protein
SwissprotQ9FYA25e-50WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLA0A0B2QA001e-107A0A0B2QA00_GLYSO; Putative WRKY transcription factor 75
TrEMBLI1KP651e-107I1KP65_SOYBN; Uncharacterized protein
STRINGGLYMA08G01430.11e-106(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.16e-51WRKY DNA-binding protein 75
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]